PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00100.1_g00015.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 282aa    MW: 32553.1 Da    PI: 5.1452
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00100.1_g00015.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM93.53.5e-29371642127
                      NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleev.ikevdiykvePwdLp.kkvkaeekewyfFskrdkkyat.gkrknratksgyWk 84 
                              ppG++F P++++l+v+yLk+ +++++++  +v i++v+iy+++P++L  + vk+++kew+f ++r k +++ +k++nr+ + g+W+
  Rsa1.0_00100.1_g00015.1  37 PPGYKFVPSEDDLIVHYLKPFLQSNNNPPPNVpIHRVNIYESNPERLSkEYVKGNDKEWFFITERTKMHERgKKKQNRSDNGGFWR 122
                              9************************98887888**************9568899999**********99983457888999***** PP

                      NAM  85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyr 127
                              a  + +e ++ ++ +   +++L  y g++++g+k++W+m ey 
  Rsa1.0_00100.1_g00015.1 123 ARSSLEEFKT-RTGVAFSRRVLEHYMGNNQNGVKSEWLMYEYL 164
                              ********99.778999*************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.1E-3333192IPR003441NAC domain
PROSITE profilePS5100533.8236192IPR003441NAC domain
PfamPF023656.9E-1537163IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MAMPPRNNRK AEPPPPSSSS AADNFSPAPL TKPTTFPPGY KFVPSEDDLI VHYLKPFLQS  60
NNNPPPNVPI HRVNIYESNP ERLSKEYVKG NDKEWFFITE RTKMHERGKK KQNRSDNGGF  120
WRARSSLEEF KTRTGVAFSR RVLEHYMGNN QNGVKSEWLM YEYLTESFPG DKSNGDIDNE  180
RVDYALCKIY MTPRGMKRKA EEEENEKKEE GGEVSQEVDQ PCNPAVQQTH LPPQPCPFSS  240
DEFHEMFNFQ DDFFTGYVDL NQLLDEDTES NNSCYLKNSS KD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A5e-163619015166Stress-induced transcription factor NAC1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM27931563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56530.11e-53NAC domain containing protein 64